Welcome to the QureGenAI 医图生科 and TyxonQ 太玄量子 platforms. Our mission is to provide a comprehensive suite of Quantum Computing + AI for Drug Discovery (Quantum AIDD) services through a powerful, developer-friendly HTTP API and Model Context Protocol (MCP).
Our platform enables researchers, developers, and large models to programmatically access state-of-the-art computational models for molecular simulation, protein structure prediction, and more.
Click To Use QureGenAI
- ✅ AutoDock GPU Molecular Docking - A traditional and fast molecular docking algorithm with reliable accuracy, ideal for high-throughput screening. GitHub
- ✅ DiffDock Molecular Docking - An AI-powered docking model based on diffusion, capable of discovering binding pockets and performing docking without a predefined location. GitHub
- ✅ Protenix Protein Structure Prediction - Predicts protein structures and complex models from sequence information alone. A trainable, open-source PyTorch reproduction of AlphaFold 3. GitHub
-
🔄 Boltz-2 - Next-generation biomolecular structure prediction model for proteins, nucleic acids, and small molecules. GitHub
-
🔄 ProteinMPNN - Deep learning method for protein sequence design using message passing neural networks. GitHub
-
🔄 RoseTTAFold - Accurate protein structure prediction using attention-based neural networks. GitHub
-
🔄 SurfDock - Surface-guided molecular docking for improved binding pose prediction. GitHub
-
🔄 OpenFE - Open-source alchemical free energy calculations for drug discovery. GitHub
-
🔄 DiffLinker - Equivariant diffusion model for molecular linker design in drug discovery. GitHub
-
🔄 MolMap - Molecular representation learning through 2D molecular maps. GitHub
-
🔄 AI2BMD - AI-powered biomolecular dynamics simulation and analysis platform. GitHub
-
🔄 BioEmu AI - Advanced biological system emulation using artificial intelligence. GitHub
We are continuously expanding our model collection to provide comprehensive AI-powered drug discovery solutions. Stay tuned for more cutting-edge models!
All API endpoints are relative to the following base URL:
https://api.quregenai.com
All API calls require authentication using an API Key. Include your API key in the Authorization header as a Bearer token.
Token Access: Getting a Key to register and obtain your API key
All requests should include the following headers:
Content-Type: application/json
Authorization: Bearer your_api_key_here
Performs molecular docking using the AutoDock algorithm.
- Endpoint:
POST /api/autodock_api/autodock_docking - Description: Submits a job for molecular docking. You must provide a receptor and one of the three ligand input types.
| Parameter | Type | Required | Description |
|---|---|---|---|
job_name |
string | No | A name for your job. |
receptor |
string | Yes | URL or server-accessible path to the receptor file (e.g., PDB format). |
center_x, center_y, center_z |
number/string | Yes | Coordinates for the center of the docking box. |
size_x, size_y, size_z |
number | No | Dimensions of the docking box. Defaults to 15 for each axis. |
ligand |
string | Yes (one of three) | Path to a single ligand file (SDF, PDB). |
ligands |
array of strings | Yes (one of three) | A list of paths to multiple ligand files. |
smiles |
string | Yes (one of three) | A SMILES string (use \n for multiple), or a path to a .txt file with SMILES strings (one per line). |
thread |
integer | No | Number of threads. Default is 1200, min is 1000. |
Note: You must provide exactly one of ligand, ligands, or smiles.
cURL
curl -X POST "https://api.quregenai.com/api/autodock_api/autodock_docking" \
-H "Content-Type: application/json" \
-H "Authorization: Bearer <your_api_key_here>" \
-d '{
"job_name": "AutoDock_Single_Ligand_Test",
"receptor": "https://files.rcsb.org/download/7RT3.pdb",
"ligand": "/path/to/your/ligand.sdf",
"center_x": -3.52,
"center_y": 5.57,
"center_z": -26.55,
"size_x": 15,
"size_y": 15,
"size_z": 15
}'Python
import requests
import os
BASE_URL = "https://api.quregenai.com"
API_KEY = os.environ.get("QUREGENAI_API_KEY", "<your_api_key_here>")
HEADERS = {
'Content-Type': 'application/json',
'Authorization': f'Bearer {API_KEY}'
}
def submit_autodock_single_ligand():
url = f"{BASE_URL}/api/autodock_api/autodock_docking"
data = {
"job_name": "AutoDock_Single_Ligand_Test",
"receptor": "https://files.rcsb.org/download/7RT3.pdb",
"ligand": "/path/to/your/ligand.sdf",
"center_x": -3.52,
"center_y": 5.57,
"center_z": -26.55
}
response = requests.post(url, headers=HEADERS, json=data)
if response.status_code == 200:
print("Job submitted successfully:", response.json())
return response.json()
else:
print(f"Error: {response.status_code}", response.text)
return None
# submit_autodock_single_ligand()Performs molecular docking using the AI-based DiffDock algorithm.
- Endpoint:
POST /api/diffdock_api/diffdock_docking - Description: Submits a DiffDock job. This is useful when the binding pocket is unknown.
| Parameter | Type | Required | Description |
|---|---|---|---|
job_name |
string | No | A name for your job. |
protein |
string | Yes | Protein file path (e.g. PDB) or sequence string. |
ligand_file |
string | Yes (one of two) | Path to a ligand file. |
smiles |
string | Yes (one of two) | A SMILES string for the ligand. |
diffusion_steps |
integer | No | Number of diffusion steps (1-100). Default: 20. |
sample_count |
integer | No | Number of samples to generate (1-100). Default: 10. |
Note: You must provide either ligand_file or smiles.
cURL
curl -X POST "https://api.quregenai.com/api/diffdock_api/diffdock_docking" \
-H "Content-Type: application/json" \
-H "Authorization: Bearer <your_api_key_here>" \
-d '{
"job_name": "DiffDock_Sequence_Test",
"protein": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKREQTGQGWVPSNYITPVN",
"smiles": "CCO"
}'Python
import requests
import os
BASE_URL = "https://api.quregenai.com"
API_KEY = os.environ.get("QUREGENAI_API_KEY", "<your_api_key_here>")
HEADERS = {
'Content-Type': 'application/json',
'Authorization': f'Bearer {API_KEY}'
}
def submit_diffdock_sequence_to_smiles():
url = f"{BASE_URL}/api/diffdock_api/diffdock_docking"
protein_sequence = "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKREQTGQGWVPSNYITPVN"
data = {
"job_name": "DiffDock_Sequence_Test",
"protein": protein_sequence,
"smiles": "CCO", # Ethanol
}
response = requests.post(url, headers=HEADERS, json=data)
if response.status_code == 200:
print("Job submitted successfully:", response.json())
return response.json()
else:
print(f"Error: {response.status_code}", response.text)
return None
# submit_diffdock_sequence_to_smiles()Predicts protein structure and complex models using the Protenix algorithm.
- Endpoint:
POST /api/protenix_api/protenix_predict - Description: Submits a job for protein structure prediction, including multi-chain complexes and complexes with DNA/RNA/ligands.
| Parameter | Type | Required | Description |
|---|---|---|---|
name |
string | Yes | A name for the prediction job. |
sequences |
array of objects | Yes | An array of sequence objects. See details below. |
seeds |
integer | No | Random seed. Default: 42. |
n_sample |
integer | No | Number of samples. Default: 5. |
n_step |
integer | No | Number of steps. Default: 150. |
n_cycle |
integer | No | Number of cycles. Default: 5. |
The sequences object has the following structure:
| Key | Type | Required | Description |
|---|---|---|---|
moduleType |
string | Yes | Type of sequence: 'proteinChain', 'dnaSequence', 'rnaSequence', 'ligand'. |
sequence |
string | Yes | The sequence content (protein sequence, DNA/RNA sequence, or SMILES for ligand). |
copy |
integer | Yes | Number of copies of this sequence (1-5). |
cURL
curl -X POST "https://api.quregenai.com/api/protenix_api/protenix_predict" \
-H "Content-Type: application/json" \
-H "Authorization: Bearer <your_api_key_here>" \
-d '{
"name": "Protein_Ligand_Complex",
"sequences": [
{
"moduleType": "proteinChain",
"sequence": "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKREQTGQGWVPSNYITPVN",
"copy": 1
},
{
"moduleType": "ligand",
"sequence": "CCO",
"copy": 1
}
]
}'Python
import requests
import os
BASE_URL = "https://api.quregenai.com"
API_KEY = os.environ.get("QUREGENAI_API_KEY", "<your_api_key_here>")
HEADERS = {
'Content-Type': 'application/json',
'Authorization': f'Bearer {API_KEY}'
}
def submit_protenix_protein_ligand():
url = f"{BASE_URL}/api/protenix_api/protenix_predict"
protein_sequence = "MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEKAVQVKVKALPDAQFEVVHSLAKWKREQTGQGWVPSNYITPVN"
data = {
"name": "Protein_Ligand_Complex",
"sequences": [
{
"moduleType": "proteinChain",
"sequence": protein_sequence,
"copy": 1
},
{
"moduleType": "ligand",
"sequence": "CCO", # Ligand SMILES
"copy": 1
}
]
}
response = requests.post(url, headers=HEADERS, json=data)
if response.status_code == 200:
print("Job submitted successfully:", response.json())
return response.json()
else:
print(f"Error: {response.status_code}", response.text)
return None
# submit_protenix_protein_ligand()Due to the long computation times for these models, all API calls are asynchronous.
-
Submit a Job: When you send a request to an API endpoint, the platform validates your request and queues a job for execution.
-
Receive a Task ID: If the submission is successful, the API returns a
200 OKresponse containing a uniquetask_id.{ "success": true, "message": "Task submitted to remote service, processing asynchronously...", "task_id": "1-68775320-15633f89-dc4744aa5c31", "job_name": "AutoDock_FAA2F6144C4611F0A525DBA75ABC6F26_1752650526" } -
Monitor Task Status: You can monitor the status of your job using the
task_idthrough the platform's web interface. Log in to the web portal, navigate to the appropriate model section (e.g., AutoDock), and find your task in the history list to view its status and retrieve results.
Note: A dedicated API endpoint for programmatically checking task status is planned for a future release.
The API uses standard HTTP status codes to indicate the success or failure of a request.
| Status Code | Meaning | Example Error Message |
|---|---|---|
400 Bad Request |
The request was malformed, missing parameters, or had conflicting parameters. | {"success": false, "message": "Missing required parameter: center_y"} |
401 Unauthorized |
The API key is missing, invalid, or the account has insufficient funds. | {"message":"Invalid or missing Authorization header","success":false} |
500 Internal Server Error |
An unexpected error occurred on the server. | Varies. |
- Sequence Lengths:
- Protein: 10-1000 amino acids
- DNA/RNA: 10-1000 bases
- File Formats:
- Protein: PDB
- Ligand: SDF, MOL2, MOL
- SMILES: Standard SMILES strings
- Performance:
- Use appropriate thread counts for AutoDock (1000-2000 recommended).
- Use URLs for large input files to avoid large request bodies.
- Task Management:
- Store the
task_idfor every submitted job. It is essential for tracking and retrieving results.
- Store the
If you encounter any issues or have questions, please contact our technical support team [email protected] or consult the detailed error logs available in the web interface.
扫码关注公众号获取最新资讯 | Scan to follow for latest updates
扫码加入开发者群进行技术交流 | Scan to join developer community

